INPUT DETAILS

Number of Residues:260

Sequence ID:sp|P17261|ERS1_YEAST Transmembrane protein ERS1 (ERD suppressor) - Saccharomyces cerevisiae (Baker's yeast).

Sequence:

	MVSLDDILGIVYVTSWSISMYPPIITNWRHKSASAISMDFVMLNTAGYSYLVISIFLQLY
	CWKMTGDESDLGRPKLTQFDFWYCLHGCLMNVVLLTQVVAGARIWRFPGKGHRKMNPWYL
	RILLASLAIFSLLTVQFMYSNYWYDWHNSRTLAYCNNLFLLKISMSLIKYIPQVTHNSTR
	KSMDCFPIQGVFLDVTGGIASLLQLIWQLSNDQGFSLDTFVTNFGKVGLSMVTLIFNFIF
	IMQWFVYRSRGHDLASEYPL

Email address:s.v.v.deevi@rdg.ac.uk

Parameters:

	 Server : targetp 	 Parameter Name : origin 	 Value : non-plant

	 Server : psort 	 Parameter Name : origin 	 Value : yeast

Index of tools run:

Running NetPhos Version 2.0

Function : Protein Phosphorylation sites Prediction

NetPhos Web Server

Actual prediction(native, unparsed form)- available only for a limited time

Threshold description :

P-scores greater than 0.5 are considered as positive predictions

Graphical Output :

Running NetOGlyc Version 3.1

Function : Protein Glycosylation sites Prediction

NetOGlyc Web Server

Actual prediction(native, unparsed form)- available only for a limited time

Threshold description :

G-scores greaterthan 0.5 are predicted as positive predictions. However for threonines an additional score is used: if the G-score is less than 0.5 but the I-score greater than 0.5 and there are no predicted neighbouring sites (distance less than 10 residues) the residue is also predicted as glycosylated.

Graphical Output :

Running PsiPred Version 2.4

Function : Secondary Structure Prediction

PSIPRED Local Server

Threshold description :

No specific threshold exists. Instead a confidence level ranging from 0 to 9 is used for the predictions. Higher the value, higher is the confidence.

Graphical Output :

Running DAS-TM filter

Function : Transmembrane protein predictions

DAS-TMfilter Web Server

Threshold description :

Emperical cuttoff value is 2.5.The residues for which the Scores are higher than both the preceding and following residues are considered as TM helix predictions

Graphical Output :

Q-Score(Quality) :0.97

Q-score is quality score for an entry of the query against a library of known TM-proteins and is used to judge whether the entry is a TM-protein or not.The value of the score is a real number between 0 and 1 (the higher the better)

Running TargetP Version 1.01

Function : Protein subcellular location Prediction

TargetP Web Server

Actual prediction(native, unparsed form)- available only for a limited time

mTP-pred : 0.068

Mitochondrial targeting peptide (mTP) prediction score

SP-pred : 0.449

Secretory pathway signal peptide (SP) prediction score

other-pred : 0.469

Other targeting peptide predictions score

Loc-pred :ANY OTHER LOCATION.

SUBCELLULAR LOCATION PREDICTION

RC-pred : 5

Reliability class(RC) is a measure of the size of the difference(diff) between the highest(winning) and the second highest output scores. It ranges from 1 to 5 and the lower the value of RC, the better the prediction.
RC 1: difference greater than 0.800
RC 2: difference less than 0.800 and greater than 0.600
RC 3: difference less than 0.600 and greater than 0.400
RC 4: difference less than 0.400 and greater than 0.200
RC 5: difference less than 0.200

TPlen-pred : no prediction

Target peptide cleavage site prediction says about the predicted length of the presequence(if any was predicted). The actual cleavage site prediction is performed by SignalP for SPs, and by ChloroP for cTPs. The mTP cleavage site prediction, however, is a TargetP-unique feature.

Running PrositeScan Version 1.20

Function : Protein profiles and motifs Prediction

Local Prositescan Server

Running TMHMM Version 2.0

Function : predictions of transmembrane helices in protein

TMHMM Web Server

Actual prediction(native, unparsed form)- available only for a limited time

Threshold description :

If memscore is the highest among the three, then it is shown as positive prediction.

Graphical Output :

Number of predicted TMHs :6

It tells about the number of Transmembrane helices found for the query protein sequence

Exp number of AAs in TMHs : 136.43041

It tells about the expected number of amino acids in Transmembrane helices. If this number is larger than 18 it is very likely to be a transmembrane protein (OR have a signal peptide).

Exp number, first 60 AAs : 39.83526

It tells about the expected number of aminoacids in Transmembrane helices in the first 60 amino acids of the protein. If this number more than a few, you should be warned that a predicted transmembrane helix in the N-term could be a signal peptide.

Total prob of N-in :0.58508

It tells about the the total probability that the N-term is on the cytoplasmic side of the membrane.

Warning : POSSIBLE N-term signal sequence

It is a warning that is produced when Exp number, first 60 AAs is larger than 10.

Running Plasmit

Function : Prediction of mitochondrial transit peptides in Plasmodium falciparum

PlasMit Web Server

Jury :NON-MITOCHONDRIAL

Mitochondrial transit peptide prediction

Reliability score : 99%

Reliability score for the prediction

Running ChloroP Version 1.1

Function : prediction of the presence of chloroplast transit peptides (cTP) in protein sequences and the location of potential cTP cleavage sites

ChloroP Web Server

Actual prediction(native, unparsed form)- available only for a limited time

Score : 0.461

It is the output score from the second step network. The prediction cTP/no cTP is based solely on this score.

cTP :Non-Chloroplast Transit Peptide

It tells whether or not this is predicted as a cTP-containing sequence.

CS-score : 2.344

It is the MEME scoring matrix score for the suggested cleavage site.

cTPlength : 32

It is the predicted length of the presequence (Please note that the prediction of the transit peptide length is carried out and presented even if its presence is not predicted).

Running PSORT Version old version

Function : prediction of protein localization sites

PSORT Web Server

Actual prediction(native, unparsed form)- available only for a limited time

endoplasmic reticulum (membrane) :0.685(Affirmative)

Description not available

plasma membrane :0.640(Affirmative)

Description not available

Golgi body :0.460(Affirmative)

Description not available

endoplasmic reticulum (lumen) :0.100(Affirmative)

Description not available