APAT: Documentation

Examples

Example of the XML format used for input to the APAT system

<input>
   <sequenceid>
      sp|P17261|ERS1_YEAST Transmembrane protein ERS1 
      (ERD suppressor) - Saccharomyces cerevisiae (Baker's yeast).
   </sequenceid>
   <sequence>
      MVSLDDILGIVYVTSWSISMYPPIITNWRHKSASAISMDFV
      MLNTAGYSYLVISIFLQLYCWKMTGDESDLGRPKLTQFDFW
      YCLHGCLMNVVLLTQVVAGARIWRFPGKGHRKMNPWYLRIL
      LASLAIFSLLTVQFMYSNYWYDWHNSRTLAYCNNLFLLKIS
      MSLIKYIPQVTHNSTRKSMDCFPIQGVFLDVTGGIASLLQL
      IWQLSNDQGFSLDTFVTNFGKVGLSMVTLIFNFIFIMQWFV
      YRSRGHDLASEYPL
   </sequence>
   <emailaddress>s.v.v.deevi@rdg.ac.uk</emailaddress>
   <parameter server='targetp' param='origin' value='non-plant' />
   <parameter server='psort' param='origin' value='yeast' />
</input>